LSTM (Long Short-Term Memory) from scratch¶
LSTM stands for Long Short-Term Memory, which is a type of artificial recurrent neural network (RNN) architecture. LSTMs are well-suited to classify, process, and predict time series data since there can be lags of unknown duration between important events in a time series.
Key Characteristics:¶
- LSTMs are designed to avoid the long-term dependency problem where the model would forget the information from earlier in the sequence.
- They are capable of learning long-term dependencies.
How It Works:¶
- Cell State: Responsible for carrying information across time steps in the network.
- Gates: LSTM has three gates to control the information flow:
- Forget Gate: Decides what information to throw away from the cell state, using a sigmoid function.
- Input Gate: Decides which new information to be used to update the cell state using a sigmoid function and a tanh function to produce new candidate values.
- Output Gate: Finally, the output gate decides which information from the cell state will be output based on a sigmoid function, filtering the current cell state which is passed through a tanh function to regulate the output.
Resources:¶
- This post provides an excellent explanation.
All formula involved
$$ \begin{aligned} f_t &= \sigma(W_f \cdot [h_{t-1}, x_t] + b_f) \\ i_t &= \sigma(W_i \cdot [h_{t-1}, x_t] + b_i) \\ \hat{C}_t &= \tanh(W_c \cdot [h_{t-1}, x_t] + b_c) \\ C_t &= f_t \cdot C_{t-1} + i_t \cdot \hat{C}_t \\ o_t &= \sigma(W_o \cdot [h_{t-1}, x_t] + b_o) \\ h_t &= o_t \cdot \tanh(C_t) \end{aligned} $$
Finally, $y_t=W_y\cdot h_t + b_t$
Prepare data set¶
Let's create a toy problem to be solved by LSTM
# Import necessary libraries
import re
import numpy as np
# Create a simple dataset for an NLP problem (e.g., predict next word)
texts = [
"I love this game, it's fantastic!",
"What a terrible game. It's too difficult. I hated it.",
"Absolutely loved the game, will beat it again.",
"Not a fan of this type of games. It is too hard",
"The game was okay, neither hard nor easy.",
"Fantastic artwork and music, really enjoyed it!",
"Worst game ever, such a torture. would not recommend.",
"Brilliant art and great gameplay.",
"Awful game, it was a waste of money. I can't even finish it.",
"Amazing story and stunning artwork.",
"this game is one of the best games i have played all i can complain about it is at the start to dificult and its to cheap",
"Perfection, Team Cherry does it again. Absolutely love the world and all the characters you can meet and all the environments (except Bilewater)",
"Love the new charm system (tools) and being able to swap out movesets (crests).",
"Tons of content and incredibly fun, absolutely recommend.",
"Really fun but really difficult and a step up from hollow knight. My favorite area: bell hart. My least favorite area: Putrified ducks. and bilewa",
"To prevent myself from imploding due to my love for this game along with its prequel",
"i hate playing this game on a keyboard",
"peak gaming storyline is excellent",
]
texts = [re.sub(r"[^a-z\s]", "", line).lower() for line in texts]
corpus = "".join(texts)
chars = sorted(set(corpus))
char_to_idx = {c: i for i, c in enumerate(chars)}
idx_to_char = {i: c for i, c in enumerate(chars)}
data_size, char_size = len(corpus), len(chars)
print(f"Data size: {data_size}, Char Size: {char_size}")
Data size: 1086, Char Size: 27
# Define the one hot encoding function
def one_hot_encode(word, char_to_idx, char_size):
one_hot_matrix = np.zeros((len(word), char_size), dtype=int)
# Fill the matrix with one hot encoded values
for i, char in enumerate(word):
idx = char_to_idx[char]
one_hot_matrix[i, idx] = 1
return one_hot_matrix
# Define the function to reverse one hot encoding
def decode_one_hot(one_hot_matrix, idx_to_char):
decoded_word = ""
for one_hot_vector in one_hot_matrix:
idx = np.argmax(one_hot_vector)
decoded_word += idx_to_char[idx]
return decoded_word
# Example usage
word = "hello"
encoded_word = one_hot_encode(word, char_to_idx, char_size)
decoded_word = decode_one_hot(encoded_word, idx_to_char)
print(f"One Hot Encoding of '{word}':\n{encoded_word}")
print(f"Decoded Word: {decoded_word}")
One Hot Encoding of 'hello': [[0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0] [0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0] [0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0] [0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0] [0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0]] Decoded Word: hello
X = one_hot_encode(corpus[:-1], char_to_idx, char_size)[:-1]
Y = one_hot_encode(corpus[1:], char_to_idx, char_size)
corpus[1:]
'love this game its fantastichat a terrible game ts too difficult hated itbsolutely loved the game will beat it againot a fan of this type of games t is too hardhe game was okay neither hard nor easyantastic artwork and music really enjoyed itorst game ever such a torture would not recommendrilliant art and great gameplaywful game it was a waste of money cant even finish itmazing story and stunning artworkthis game is one of the best games i have played all i can complain about it is at the start to dificult and its to cheaperfection eam herry does it again bsolutely love the world and all the characters you can meet and all the environments except ilewaterove the new charm system tools and being able to swap out movesets crestsons of content and incredibly fun absolutely recommendeally fun but really difficult and a step up from hollow knight y favorite area bell hart y least favorite area utrified ducks and bilewao prevent myself from imploding due to my love for this game along with its prequeli hate playing this game on a keyboardpeak gaming storyline is excellent'
decode_one_hot(Y, idx_to_char)
'love this game its fantastichat a terrible game ts too difficult hated itbsolutely loved the game will beat it againot a fan of this type of games t is too hardhe game was okay neither hard nor easyantastic artwork and music really enjoyed itorst game ever such a torture would not recommendrilliant art and great gameplaywful game it was a waste of money cant even finish itmazing story and stunning artworkthis game is one of the best games i have played all i can complain about it is at the start to dificult and its to cheaperfection eam herry does it again bsolutely love the world and all the characters you can meet and all the environments except ilewaterove the new charm system tools and being able to swap out movesets crestsons of content and incredibly fun absolutely recommendeally fun but really difficult and a step up from hollow knight y favorite area bell hart y least favorite area utrified ducks and bilewao prevent myself from imploding due to my love for this game along with its prequeli hate playing this game on a keyboardpeak gaming storyline is excellent'
Base Model¶
The base model is naive and can only predict via forward propagation. This is a random model.
class BaseLSTM:
char_to_idx = {c: i for i, c in enumerate(chars)}
idx_to_char = {i: c for i, c in enumerate(chars)}
@staticmethod
def xavier_init(input_size, output_size):
return np.random.uniform(-1, 1, (input_size, output_size)) * np.sqrt(
6 / (input_size + output_size)
)
def __init__(self, input_size, hidden_size, output_size=27):
# Initialize random weights and biases
self.input_size = input_size
self.hidden_size = hidden_size
self.output_size = output_size
combined_size = input_size + hidden_size
self.combined_size = combined_size
# forget gate
# W_f is of size [input_size, hidden_size]
# so that multiplication of
self.W_f = self.xavier_init(hidden_size, combined_size)
self.b_f = np.zeros((hidden_size, 1))
# input gate
self.W_i = self.xavier_init(hidden_size, combined_size)
self.b_i = np.zeros((hidden_size, 1))
# candidate gate
self.W_C = self.xavier_init(hidden_size, combined_size)
self.b_C = np.zeros((hidden_size, 1))
# output gate
self.W_o = self.xavier_init(hidden_size, combined_size)
self.b_o = np.zeros((hidden_size, 1))
# output layer
self.W_y = self.xavier_init(output_size, hidden_size)
self.b_y = np.zeros((output_size, 1))
self.states = {
"combined": {},
"input_gates": {},
"forget_gates": {},
"candidate_gates": {},
"output_gates": {},
"outputs": {},
"hidden": {},
"cell": {},
}
def reset_states(self):
for k in self.states.keys():
self.states[k] = {}
# set an initial prev state to avoid cold start out of index exception
self.states["hidden"][-1] = np.zeros(self.hidden_size).reshape(-1, 1)
self.states["cell"][-1] = np.zeros(self.hidden_size).reshape(-1, 1)
@staticmethod
def sigmoid(x, derivative=False):
if derivative:
return x * (1 - x)
return 1 / (1 + np.exp(-x))
@staticmethod
def tanh(x, derivative=False):
if derivative:
return 1 - x**2
return np.tanh(x)
@staticmethod
def softmax(y):
e = np.exp(y - np.max(y))
return e / np.sum(e)
def predict_scores(self, X):
self.reset_states()
pred = []
for t in range(len(X)):
# dimension check
# X.shape = [1, input_size (or vocab size)]
# combined.shape = [1, input_size + hidden_size]
combined = np.concat((self.states["hidden"][t - 1], X[t].reshape(-1, 1)))
self.states["combined"][t] = combined
# Forget gate:
# W_f: [hidden_size, input_size + hidden_size]
# combined: [1, input_size + hidden_size]
# b_f: [hidden_size, 1]
# Expect f_t: [50,1]
self.states["forget_gates"][t] = self.sigmoid(
self.W_f @ combined + self.b_f
)
# Input gate:
# W_i: [hidden_size, input_size + hidden_size]
# b_i: [hidden_size, 1]
# Expect i_t: [50,1]
self.states["input_gates"][t] = self.sigmoid(self.W_i @ combined + self.b_i)
# Candidate gate:
# W_C: [hidden_size, input_size + hidden_size]
# b_C: [hidden_size, 1]
# Expect C_hat_t: [50,1]
self.states["candidate_gates"][t] = self.tanh(
self.W_C @ combined + self.b_C
)
# Update cell state:
# C_t = f_t * C_prev + i_t * C_hat_t
# f_t: [50,1]
# C_prev: [50,1]
# i_t: [50,1]
# C_hat_t: [50,1]
# Expect C_t: [50,1]
self.states["cell"][t] = (
self.states["forget_gates"][t] * self.states["cell"][t - 1]
+ self.states["input_gates"][t] * self.states["candidate_gates"][t]
)
# Output gate:
# W_o: [hidden_size, input_size + hidden_size]
# b_o: [hidden_size, 1]
# Expect o_t: [output_size, 1]
self.states["output_gates"][t] = self.sigmoid(
self.W_o @ combined + self.b_o
)
# h_t = o_t * tanh(C_t)
self.states["hidden"][t] = self.states["output_gates"][t] * self.tanh(
self.states["cell"][t]
)
# W_y: [output_size, hidden_size]
# h_t: [hidden_size, 1]
# b_y: [output_size, 1]
output = self.softmax(self.W_y @ self.states["hidden"][t] + self.b_y)
self.states["outputs"][t] = output
pred.append(output)
return pred
def predict(self, X):
scores = self.predict_scores(X)
decoded_text = ""
for score in scores:
idx = np.argmax(score)
decoded_text += idx_to_char[idx]
return decoded_text
How good is a random model?¶
Try a hidden layer size of 50. The prediction is indeed terrible as expected!
# Initialize the model
hidden_size = 50 # Example hidden size
input_size = char_size # We are using one-hot encoded characters as inputs
model = BaseLSTM(input_size, hidden_size)
pred = model.predict(X)
pred
'qkdwsqlrwwqcbeaqdldqrrrorrodfuuoqbqlsccdykvqcbeaqldqloomddyymackpqquuoadqdlwyydooskmmmmwssqlraqcbeaqewdkqwaboqwlqqrbhudombqrrrmmrmmmmdmlmraqdymrbeaaqlqwdqldommrurraqcbeaqebqqmrbmmradlkacquuudqdddqabymrrorrodfqgupenynqqrrrelyddqcvbkkmmavvdmadddlddyoqrbeaqawscqyyozmbmmodolppqnnykdmddomdaxonefdddddkdhuoqgupqqrrrrcvboqrbeafdbzeppkmrbeaqdlqfeqqbqebqosqdymeyoammmubuomadsvqrmdddmmwdfelldrvaoodmmrrrrdooorddrvbupenynormdmcbeaqddqddaadymomamwayoqrbeaaqdquuqaqrdbmadqbkkmwquuuquanddbedmbeboomdlfwdqqoqlraqyorupqlomddydfckpqbrrmdldqldmuuabracyappdddmabequaucyqdnssqdlqqrbeumwyddooskmmmmwsqlraqwnyydqbrrmbkkmluaquuuubuppcyqmmymobomeaalqqrrqbkkmluaqaddwddddadodqsuuaapqwdafblfcypsqlkaqdadquuuueqymyrsfqlookymbrrrgaddvvbe avldmydbrqmnomenwssslsqtcayoyooammrmaaooaaolgrrrdducvddwdmmmyrmbgyykooskmmxvxpnefddsbjkmmmprm yoqcvbkkmmddgymdckpqbrrrbqqosrqcrqrcynqmmkkmemnrdvrrmmmmrmmvdlffquvbqtadkqmuupqmmmabqomrrmmpdlffquvbqqopdygvdddnonsqbrrrgddafbbqrcapsvlqfmyadpmmcyyqdffdddddvvdlsjlomnmmmmwsqyyymlrwwmrbeaqbkmormedlwqwldqrcvulsjdquuoaqrdbmmdrvlrwdqcbeaqddmbmraz ybcdrsbgqrbeedvvasodmkmdavddqauuaaka'
Backpropagation¶
The fun part. Skip the math here since it's hard, but if you are up for it, here's an article. The key things to know are:
- Loss function. This is the standard loss function for probability prediction. At time t, the loss is $L_t = \sum_{i=1}^{m} -y_{i,t} \log(\hat{y}_{i,t})$, where m is the dimension of the output. In our case it's the vocabulary size of one-hot encoding, 27.
- Total loss. The total loss going back from the last step to the current step is $L_{total} = \sum_{t=1}^{n} L_t$. This creates a dependency between neighbor steps. Partial derivatives goes from next to previous.
class LSTM(BaseLSTM):
def __init__(self, input_size, hidden_size, learning_rate, output_size=27, clip_value=5.0):
super().__init__(input_size, hidden_size, output_size)
self.learning_rate = learning_rate
self.clip_value=clip_value
def backpropagation(self, errors, X):
dW_f = np.zeros_like(self.W_f)
dW_i = np.zeros_like(self.W_i)
dW_C = np.zeros_like(self.W_C)
dW_o = np.zeros_like(self.W_o)
dW_y = np.zeros_like(self.W_y)
db_f = np.zeros_like(self.b_f)
db_i = np.zeros_like(self.b_i)
db_C = np.zeros_like(self.b_C)
db_o = np.zeros_like(self.b_o)
db_y = np.zeros_like(self.b_y)
dh_next = np.zeros((self.hidden_size, 1))
dC_next = np.zeros((self.hidden_size, 1))
f = self.states["forget_gates"]
i = self.states["input_gates"]
o = self.states["output_gates"]
C_bar = self.states["candidate_gates"]
C = self.states["cell"]
h = self.states["hidden"]
for t in reversed(range(len(errors))):
# Error at step t
e = errors[t]
# Going back in the reverse order
# Output layer
dW_y += e @ h[t].T # [V, 1] @ [1, H] = [V, H]
db_y += e # [V, 1]
# Gradient w.r.t. hidden state
dh = self.W_y.T @ e + dh_next # [H, V] @ [V, 1] + [H, 1] = [H, 1]
# Output gate
do = dh * np.tanh(C[t]) # [H, 1] * [H, 1] = [H, 1]
do_raw = do * o[t] * (1 - o[t]) # [H, 1]
# Cell state
dC = dh * o[t] * (1 - np.tanh(C[t]) ** 2) + dC_next # [H, 1]
# Candidate gate
dC_bar = dC * i[t] # [H, 1]
dC_bar_raw = dC_bar * (1 - C_bar[t] ** 2) # [H, 1]
# Forget gate
df = dC * C[t - 1] if t > 0 else np.zeros_like(C[t]) # [H, 1]
df_raw = df * f[t] * (1 - f[t]) # [H, 1]
# Input gate
di = dC * C_bar[t] # [H, 1]
di_raw = di * i[t] * (1 - i[t]) # [H, 1]
# Combined input [h_{t-1}; x_t]
x_h = (
np.concatenate((h[t - 1], X[t].reshape(-1, 1)))
if t > 0
else np.concatenate(
(np.zeros((self.hidden_size, 1)), X[t].reshape(-1, 1))
)
) # [C, 1]
# Accumulate weight gradients: [H, 1] @ [1, C] = [H, C]
dW_f += df_raw @ x_h.T
db_f += df_raw
dW_i += di_raw @ x_h.T
db_i += di_raw
dW_C += dC_bar_raw @ x_h.T
db_C += dC_bar_raw
dW_o += do_raw @ x_h.T
db_o += do_raw
# Gradient w.r.t. combined input, then extract h portion
dh_prev = (
self.W_f.T @ df_raw +
self.W_i.T @ di_raw +
self.W_C.T @ dC_bar_raw +
self.W_o.T @ do_raw
)
dh_next = dh_prev[:self.hidden_size, :] # [H, 1]
dC_next = dC * f[t] # [H, 1]
# Clip gradients to prevent exploding gradients
for grad in [
dW_f, dW_i, dW_C, dW_o, dW_y,
db_f, db_i, db_C, db_o, db_y
]:
np.clip(
grad,
-self.clip_value,
self.clip_value,
out=grad
)
# Gradient descent update
self.W_f -= self.learning_rate * dW_f
self.b_f -= self.learning_rate * db_f
self.W_i -= self.learning_rate * dW_i
self.b_i -= self.learning_rate * db_i
self.W_C -= self.learning_rate * dW_C
self.b_C -= self.learning_rate * db_C
self.W_o -= self.learning_rate * dW_o
self.b_o -= self.learning_rate * db_o
self.W_y -= self.learning_rate * dW_y
self.b_y -= self.learning_rate * db_y
def train(self, X, Y, epochs, seq_len=25):
for epoch in range(epochs):
total_loss = 0
h_prev = np.zeros((self.hidden_size, 1))
c_prev = np.zeros((self.hidden_size, 1))
for start in range(0, len(X) - seq_len, seq_len):
X_chunk = X[start:start + seq_len]
Y_chunk = Y[start:start + seq_len]
self.reset_states()
self.states["hidden"][-1] = h_prev
self.states["cell"][-1] = c_prev
y_pred = self.predict_scores(X_chunk)
errors = []
for t in range(len(Y_chunk)):
target = Y_chunk[t].reshape(-1, 1) # [V, 1]
loss = -np.sum(target * np.log(np.clip(y_pred[t], 1e-8, 1 - 1e-8)))
total_loss += loss
error = y_pred[t] - target # [V, 1]
errors.append(error)
self.backpropagation(errors, X_chunk)
h_prev = self.states["hidden"][seq_len - 1]
c_prev = self.states["cell"][seq_len - 1]
if (epoch + 1) % 10 == 0 or epoch == 0:
print(f"Epoch {epoch+1}/{epochs}, "f"Loss: {total_loss:.4f}")
learning_rate = 0.001
hidden_size = 50
epochs = 200
lstm_model = LSTM(input_size=char_size, hidden_size=hidden_size, learning_rate=learning_rate, output_size=char_size)
lstm_model.train(X, Y, epochs)
Epoch 1/200, Loss: 3308.3916 Epoch 10/200, Loss: 2918.8548 Epoch 20/200, Loss: 2555.2144 Epoch 30/200, Loss: 2205.4830 Epoch 40/200, Loss: 1827.7179 Epoch 50/200, Loss: 1480.2018 Epoch 60/200, Loss: 1158.4505 Epoch 70/200, Loss: 946.1107 Epoch 80/200, Loss: 718.4358 Epoch 90/200, Loss: 973.9694 Epoch 100/200, Loss: 499.7138 Epoch 110/200, Loss: 392.8042 Epoch 120/200, Loss: 1126.7590 Epoch 130/200, Loss: 372.9498 Epoch 140/200, Loss: 311.6843 Epoch 150/200, Loss: 276.7674 Epoch 160/200, Loss: 323.1867 Epoch 170/200, Loss: 264.9178 Epoch 180/200, Loss: 236.9760 Epoch 190/200, Loss: 217.3146 Epoch 200/200, Loss: 202.0721
lstm_model.predict(X)
'oove thes game its fantas c aa y trrribnew ane ts tomssaauicult hated itbeeritery cune ghe game toslaaeas w apain t a faniat hhe gaoe oo games t cpc omhard a mame was okkklle tha etard non easyag ytituant are abd mus c eepso dagrrel ncemet game ato sfcsianterthry wolll ana cemmmmendrilliant atter saarea oameplaywfrniiune apttolmestayff cavdsslhant avea finish at ring storyland stunnii ebe ee game it on tk chi beat lames i haverplayin ikl i can complayngwkeithot as at the staniaahngicuthl a d its torsaan laeett ee eam herryefee tit again bs lutily covedto gorll nnd alltthe fo sitis s aouscan meetealgagrltthe n ironments tnme t oromorerone whissermmoast pflten tools and aultc attontvywwap uut myversls crett ns if cont e endrst aldibsd fun abetee yy dedok antsally faf cetemedsly diffinult and ilb e up from hollow wt vmeei lanorite area beroyiiniwa naalt epftretena ea bneelleg iucks and bstlii a oaendis sinl droc sllleving due to my love tinech s game illng withaar are enla hate playibo shes game in a keyboari aakedrmeng storyline isoonmmpoy '
Fair! Some words are readible